PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462938999
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HB-other
Protein Properties Length: 326aa    MW: 35336.8 Da    PI: 4.445
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462938999genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.61.1e-0874112341
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-H CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLte 41 
                k++++t+eq++ Le+ Fe+++++  e+++eLA+klgL+ 
  462938999  74 KKRRLTPEQVHLLEKSFEEENKLEPERKTELARKLGLQP 112
                5678*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.64E-767113IPR009057Homeodomain-like
SMARTSM003890.002172141IPR001356Homeobox domain
PfamPF000464.1E-674112IPR001356Homeobox domain
CDDcd000862.17E-774112No hitNo description
Gene3DG3DSA:1.10.10.602.2E-875113IPR009057Homeodomain-like
PfamPF021835.3E-15114148IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MDSGRLIFNT TGSGAGQMLF LDCGMGGPGG GGMFHRGGRP VLGLDEGRGV KRPFFTSPDE  60
LLEEEYYDEQ LPEKKRRLTP EQVHLLEKSF EEENKLEPER KTELARKLGL QPAKQLERDF  120
DRLKASFDAL RADHDALLQD NHRLRSQVRI VVSFSFVHGR APVVHVVSLT EKLQEKEEAE  180
GAASAAADFP AADVKASLAV DDAEEATAAE LAFEAHHVKS EDRLSSGSGG SAVVDADALL  240
CGGGLAAAVD SSVESYHYHD CGMGPVDHYA GEFGQSEEDD GAGSDEGCSY HADDAAAAAV  300
FFAGHAHHQH VDEEEDDGQI SWWMWN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0652671e-116BT065267.1 Zea mays full-length cDNA clone ZM_BFb0074N09 mRNA, complete cds.
GenBankBT0653521e-116BT065352.1 Zea mays full-length cDNA clone ZM_BFb0114N22 mRNA, complete cds.
GenBankBT0865861e-116BT086586.1 Zea mays full-length cDNA clone ZM_BFc0188G07 mRNA, complete cds.
GenBankEU9615281e-116EU961528.1 Zea mays clone 236181 homeodomain leucine zipper protein CPHB-5 mRNA, complete cds.
GenBankEU9619491e-116EU961949.1 Zea mays clone 239214 homeodomain leucine zipper protein CPHB-5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006647837.11e-127PREDICTED: homeobox-leucine zipper protein HOX16 isoform X1
SwissprotQ6YWR41e-116HOX16_ORYSJ; Homeobox-leucine zipper protein HOX16
TrEMBLC0PAE81e-134C0PAE8_MAIZE; Uncharacterized protein
STRINGOB02G38180.11e-127(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26093887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.14e-35homeobox 1